PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0657.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 847aa    MW: 94405.1 Da    PI: 5.3137
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0657.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85e-29559609252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Bostr.7128s0657.1.p 559 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 609
                          689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.109543629IPR003035RWP-RK domain
PfamPF020423.3E-25561609IPR003035RWP-RK domain
SuperFamilySSF542773.68E-23737834No hitNo description
PROSITE profilePS5174529.358746829IPR000270PB1 domain
SMARTSM006665.5E-27746829IPR000270PB1 domain
PfamPF005641.1E-19747828IPR000270PB1 domain
CDDcd064076.82E-44747827No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-21747826No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MEDSFLQTEN AIMDSEFMDG LLLDGCWLET TDGSEFLNVA PSTSSVSPFD PSSFMWSPTQ  60
DTSAICTSGV VSQMYGQDCA ERSSLDDFQW NKRWWIGPGG GGSSVTERLV QAVEHIKDYT  120
TERGSLIQLW VPVNRGGKRV LTTKEQPFSH DPMCQRLANY REISVNYHFP AEQDDSKAVA  180
GLPGRVFLGK LPEWTPDVRF FKSEEYPRVH HAQDCDVRGT LAIPVFEQGS KICLGVIEVV  240
MTTEMVKLRP ELESICRALQ AVDLRSTELP IPPSLKGCDL SYKAALPEIR NLLRCACETH  300
KLPLAQTWVS CLQQSKSGCR HNDENYIHCV STIDDACYVG DPTVREFHEA CSEHHLLKGQ  360
GVAGQAFLTN GPCFSSDVSN YKKSEYPLSH HANMYGLHGV VAIRLRCIHT GSSDFVLEFF  420
LPKDCNDLEE QRKMLNALST IMAHVPRSLR TVTDKELEEE SEVIEREEIV TPKIENASEL  480
QHLHGNSPWS ASLEEIQRSN SSSNPQNLGL VFDGGDKPND GFGLKRGFDY TMDSNVNESS  540
TFSSGGFSMM TEKKRTKADK TITLDVLRQY FAGSLKDAAK NIGVCPTTLK RICRQHGIQR  600
WPSRKIKKVG HSLQKIQRVI DSVQGVSGPL PIGSFYANFP NLVSQSQNPS QQAKTSPPPP  660
PPVELAKSPV SSYSQSSNSS QCCSSETQLN SGATTDPASA DVVGSLKKTS SEIELQSSSL  720
DETILTLSSL ENIPQGTNLS SQDDDFLRIK VSYGEEKIRF RMPNSRRLTD LLWEIGKRFS  780
IEDMSRYDLK YLDEDNEWVL LTCDEDVEEC VDVCRTTPSH TIKLLLQVSS HHFPERSSAT  840
EYSLWH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306759.10.0hypothetical protein CARUB_v10008300mg
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein